PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_34860V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 280aa    MW: 30518.1 Da    PI: 4.376
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_34860V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC34.64.2e-111693098
              NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                       ++ade+v +i+  +Pvl+ska elf+ +l  +++  +     +t+    ++++v+   +fdfl +iv +
  Pp3c3_34860V3.4.p  1 MQADEEVGKIAMATPVLISKALELFLQNLCDKTYEITLRRGAKTMSSFHLKQCVQTNSVFDFLQEIVSK 69
                       899**************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.3E-10154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.6E-18168IPR009072Histone-fold
SuperFamilySSF471135.82E-19171IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MQADEEVGKI AMATPVLISK ALELFLQNLC DKTYEITLRR GAKTMSSFHL KQCVQTNSVF  60
DFLQEIVSKV PDIGTETTCD ERNGGRRRKQ SDGDDSDEEE VVKRPKSEDQ STSGRGRGRG  120
RGRGRGRGRG RGSNGTPSSR SNGVEKAEDS EDAEMDTYSP SPDRENVILD PIVHKPRPKS  180
EEAAARDASP TSSGHTKSPK LLGFDLNMDL DENGEVAAGA DEATVNEEEV EHDGSNVPTQ  240
DLDVDSENVL GGTLHLQRSE LRPSLHPDED DYDCEDEDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A3e-161552175Transcription Regulator NC2 alpha chain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120130RGRGRGRGRGR
2122131RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S112_139V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.17e-38nuclear factor Y, subunit C11